Protein coding transcript 116010

• Transcript: Ll_transcript_473617
• CDS coordinates: 1213-1947 (+)
• Peptide sequence: MSNSESREDESKEEDKDNEANKLLQHQSSSSSDNEEEVAYENGDKITIVDFDYVDGDEDSNVTPPFSWKKLWVFTGPGFLMSIAFLDPGNLEGDLQAGAIAGYSLLWLLMWATVMGLLIQLLSARVGVATGRHLAELCRDEYPNWARYVLWFMAELALIGADIQEVIGSAIAIQILSHGVLPLWAGVLITASDCFFFLFLENYGVRKLEAAFAVLIATMGLSFAWMFADTKPNGKELLMGKSYK*
• ORF Type: complete

Annotations of Ll_transcript_473617

• Blastp: Metal transporter Nramp2 from Arabidopsis with 76.69% of identity
• Blastx: Metal transporter Nramp2 from Arabidopsis with 82.78% of identity
• Eggnog: H( )-stimulated, divalent metal cation uptake system (By similarity)(COG1914)
• Kegg: Link to kegg annotations (AT1G47240)
• CantataDB: -
• Mirbase: tcc-MIR393a (MI0017505)
• Ncbi protein: Link to NCBI protein (XP_019417585.1)
• Pfam: Natural resistance-associated macrophage protein (PF01566.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;