Transcript | Ll_transcript_473629 |
---|---|
CDS coordinates | 1591-2193 (+) |
Peptide sequence | MSNSESREDESKEEDKDNEANKLLQHQSSSSSDNEEEVAYENGDKITIVDFDYVDGDEDSNVTPPFSWKKLWVFTGPGFLMSIAFLDPGNLEGDLQAGAIAGYSLLWLLMWATVMGLLIQLLSARVGVATGRHLAELCRDEYPNWARYVLWFMAELALIGADIQEVIGSAIAIQILSHGVLPLWAGVLITASDWYFAAKT* |
ORF Type | complete |
Blastp | Metal transporter Nramp2 from Arabidopsis with 73.44% of identity |
---|---|
Blastx | Metal transporter Nramp2 from Arabidopsis with 86.26% of identity |
Eggnog | H( )-stimulated, divalent metal cation uptake system (By similarity)(COG1914) |
Kegg | Link to kegg annotations (AT1G47240) |
CantataDB | - |
Mirbase | tcc-MIR393a (MI0017505) |
Ncbi protein | Link to NCBI protein (XP_019417585.1) |
Pfam | Natural resistance-associated macrophage protein (PF01566.17) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer