Protein coding transcript 116034

• Transcript: Ll_transcript_474468
• CDS coordinates: 1-342 (+)
• Peptide sequence: IFVSNRAILNHLLLWVSQSSHFLSFKVDTMSITNWEADKMLDVYIYNYLVKRQLHTSASVFQAEANVPTDSIATDTPNSFLFEWWSVFWDIFIARTGQKHSEAAAFYIKVGYF*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_474468

• Blastp: Transcriptional corepressor LEUNIG from Arabidopsis with 70% of identity
• Blastx: Transcriptional corepressor LEUNIG from Arabidopsis with 70% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AT4G32551)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019439569.1)
• Pfam: LisH (PF08513.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;