Protein coding transcript 116071

• Transcript: Ll_transcript_473173
• CDS coordinates: 1-555 (+)
• Peptide sequence: ERPMPVRKRMFGRAWPLGQPVKSGNVPTWPQLSAGGSVPCTDDEVATEWLNNEAVRKAIHTIEKSVVSKWELCTDNIKYKHNEGSMIPFHKKLTSKGYRALIFSGDHDLCVPYTGSQAWTSSMGYKIVDEWRPWLVDDQIAGFTQGYDKNLTFLTIKGAGHTVPEYKPKESLYFYKRFLDGLSV*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_473173

• Blastp: Serine carboxypeptidase-like 21 from Arabidopsis with 69.06% of identity
• Blastx: Serine carboxypeptidase-like 21 from Arabidopsis with 69.06% of identity
• Eggnog: carboxy-peptidase(COG2939)
• Kegg: Link to kegg annotations (AT3G25420)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019460180.1)
• Pfam: Serine carboxypeptidase (PF00450.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;