Protein coding transcript 116075

• Transcript: Ll_transcript_473180
• CDS coordinates: 2-373 (+)
• Peptide sequence: GEKSVVSQWEICTNNIDYKHDEDSMIPFHKNLTSEGYRALIFSGDHDLCVPYTGSQAWTSSMGYKIVDEWRPWLVDGQVAGFTQGYEKNLTFTTIKGSGHTVPEYKPKESLYFYKRFLDGLPL*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_473180

• Blastp: Serine carboxypeptidase-like 21 from Arabidopsis with 68.91% of identity
• Blastx: Serine carboxypeptidase-like 21 from Arabidopsis with 68.91% of identity
• Eggnog: carboxy-peptidase(COG2939)
• Kegg: Link to kegg annotations (AT3G25420)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019460179.1)
• Pfam: Serine carboxypeptidase (PF00450.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;