Protein coding transcript 116078

• Transcript: Ll_transcript_473184
• CDS coordinates: 3-362 (+)
• Peptide sequence: EGNPSKDPVVLWLNGGPGCSSFDGFIYEHGPFNFEKPKTKGTLPKLHLNPYSWSKVSNIIYLDSPAGTGFSYSKNESDYRTGDLKTGNDLYTFLLEWFKLYPEFLSNSLFIGGDTYAGVN
• ORF Type: internal

Annotations of Ll_transcript_473184

• Blastp: Serine carboxypeptidase 1 from Oryza sativa with 74.79% of identity
• Blastx: Serine carboxypeptidase 1 from Oryza sativa with 74.79% of identity
• Eggnog: carboxy-peptidase(COG2939)
• Kegg: Link to kegg annotations (4351908)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019460180.1)
• Pfam: Serine carboxypeptidase (PF00450.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;