| Transcript | Ll_transcript_473469 |
|---|---|
| CDS coordinates | 314-652 (+) |
| Peptide sequence | MVDEQGMFLPLIVPPTIYQAGLWSTWLAVLCSLKMFQALARDRLERLNASPSATPWTYLRVYSALLFVFLVDVLWYCLLFSNATFILFYYHPSCCYYNTGDSICILFFMWFC* |
| ORF Type | complete |
| Blastp | E3 ubiquitin protein ligase RIN2 from Arabidopsis with 52.25% of identity |
|---|---|
| Blastx | E3 ubiquitin protein ligase RIN2 from Arabidopsis with 49.61% of identity |
| Eggnog | zinc ion binding(COG5243) |
| Kegg | Link to kegg annotations (AT4G25230) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_003522880.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer