Protein coding transcript 116120

• Transcript: Ll_transcript_473464
• CDS coordinates: 314-811 (+)
• Peptide sequence: MVDEQGMFLPLIVPPTIYQAGLWSTWLAVLCSLKMFQALARDRLERLNASPSATPWTYLRVYSALLFVFLVDVFWIRLCLAIYRTHRSSLFLLLFFEPLSIAFETLQAILVHGFQLVDIWCNSSDCQRPKLFDKLAAGSLLEWKGTLIRNLGFFLDMATFFMALGH
• ORF Type: 3prime_partial

Annotations of Ll_transcript_473464

• Blastp: E3 ubiquitin protein ligase RIN2 from Arabidopsis with 68.86% of identity
• Blastx: E3 ubiquitin protein ligase RIN2 from Arabidopsis with 66.48% of identity
• Eggnog: zinc ion binding(COG5243)
• Kegg: Link to kegg annotations (AT4G25230)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427189.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;