| Transcript | Ll_transcript_317092 |
|---|---|
| CDS coordinates | 183-491 (+) |
| Peptide sequence | MSLPIPLLSSTSKNNMAFHDHHKHTQGANADTSETKRIEEESGHEQRTSLSRKMSESSIAVTEEEDDDVDRKIELGPQCTLKQQLEKDKVINCLFFLSLLLT* |
| ORF Type | complete |
| Blastp | Rho GDP-dissociation inhibitor 1 from Arabidopsis with 65.85% of identity |
|---|---|
| Blastx | Rho GDP-dissociation inhibitor 1 from Arabidopsis with 65.85% of identity |
| Eggnog | Rho GDP dissociation inhibitor (GDI)(ENOG4111K44) |
| Kegg | Link to kegg annotations (AT3G07880) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019464521.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer