Protein coding transcript 11618

• Transcript: Ll_transcript_317093
• CDS coordinates: 97-525 (+)
• Peptide sequence: MNSVGESVEPEVKMLSLAIQTGGRADIVLPIPENGNPNGLWFTLKEGSRYRLMFTFQVSNNIVSGLKYSNTVWKTGIKVDSTKEMIGTFSPQAEPYTHEMPEETTPSGIFARGAYSARTKFLDDDNKLYLEINYTFDIRKEW*
• ORF Type: complete

Annotations of Ll_transcript_317093

• Blastp: Rho GDP-dissociation inhibitor 1 from Arabidopsis with 74.65% of identity
• Blastx: Rho GDP-dissociation inhibitor 1 from Arabidopsis with 76.73% of identity
• Eggnog: Rho GDP dissociation inhibitor (GDI)(ENOG4111K44)
• Kegg: Link to kegg annotations (AT3G07880)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019464522.1)
• Pfam: RHO protein GDP dissociation inhibitor (PF02115.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;