Protein coding transcript 116180

• Transcript: Ll_transcript_474658
• CDS coordinates: 899-1363 (+)
• Peptide sequence: MYNSRTGVDIPIQQSYLWYGSSEGDISDSQASGAYIFRPNESPPTVVPRSVPYEVIRGPLVDEIRQKFSSWIYQVTRLYKDKDHAEIEFTIGPIPIDDGVGKEVITRLATNMVTNKEFYTDSNGRDFLKRVTHTIYLLFSEIIHEKCDIDFCNK*
• ORF Type: complete

Annotations of Ll_transcript_474658

• Blastp: Alpha-mannosidase from Canavalia with 78.79% of identity
• Blastx: Alpha-mannosidase from Canavalia with 67.09% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003629280.1)
• Pfam: Glycosyl hydrolases family 38 C-terminal domain (PF07748.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;