| Transcript | Ll_transcript_473090 |
|---|---|
| CDS coordinates | 94-444 (+) |
| Peptide sequence | MFFLPFTNFPANKHVGLFDSQELKQYPGLRVEVGTAAIESLEKMREDSRKAALLLVDMEIGYLTVDFFRKLPQDVDKGGNPTHSLFDRYNDSYLRRIGKPYKLLFQTRTEITALCY* |
| ORF Type | complete |
| Blastp | Dynamin-related protein 5A from Soja with 76.47% of identity |
|---|---|
| Blastx | Dynamin-related protein 5A from Soja with 57.96% of identity |
| Eggnog | Dynamin family(COG0699) |
| Kegg | Link to kegg annotations (100037461) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019446505.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer