Protein coding transcript 116258

• Transcript: Ll_transcript_473074
• CDS coordinates: 1774-2205 (+)
• Peptide sequence: MREESRKSTLLLVDMECGYLTVDFFRKLPQEVDKGGNPTHSIFDRYNDSYLRRIGTTILSYVNMVCATLRHAIPKSIVYCQVREAKRSLLDHFFTDLGKMDPKRLSALLNEDPEVMERRSALAKRLELYRSAQDEIDAVAWSK*
• ORF Type: complete

Annotations of Ll_transcript_473074

• Blastp: Dynamin-related protein 5A from Soja with 89.51% of identity
• Blastx: Dynamin-related protein 5A from Soja with 88.02% of identity
• Eggnog: Dynamin family(COG0699)
• Kegg: Link to kegg annotations (100037461)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421954.1)
• Pfam: Dynamin GTPase effector domain (PF02212.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;