| Transcript | Ll_transcript_472435 |
|---|---|
| CDS coordinates | 444-833 (+) |
| Peptide sequence | MMVFEINNDFVQVIGVISAILLLVSLRVKVASCDEYPAMHCRKHSAFLTDFGGVGDGKTCNTKAFQYAISNLSQYACDGGALLVVPPGKWLTGSFNLTSHFTLFLQKDAVILASQVFTYSPFFSTIINS* |
| ORF Type | complete |
| Blastp | Probable polygalacturonase from Vitis with 65.22% of identity |
|---|---|
| Blastx | Probable polygalacturonase from Vitis with 72.88% of identity |
| Eggnog | Glycoside hydrolase family 28(COG5434) |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019450638.1) |
| Pfam | Pectate lyase superfamily protein (PF12708.6) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer