Transcript | Ll_transcript_472441 |
---|---|
CDS coordinates | 237-623 (+) |
Peptide sequence | MKHYSKLKNFHVIGVISAILLLVSLRVKVASCDEYPAMHCRKHSAFLTDFGGVGDGKTCNTKAFQYAISNLSQYACDGGALLVVPPGKWLTGSFNLTSHFTLFLQKDAVILASQVFTYSPFFSTIINS* |
ORF Type | complete |
Blastp | Probable polygalacturonase from Vitis with 68.97% of identity |
---|---|
Blastx | Probable polygalacturonase from Vitis with 74% of identity |
Eggnog | Glycoside hydrolase family 28(COG5434) |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019450638.1) |
Pfam | Pectate lyase superfamily protein (PF12708.6) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer