Transcript | Ll_transcript_472442 |
---|---|
CDS coordinates | 444-833 (+) |
Peptide sequence | MMVFEINNDFVQVIGVISAILLLVSLRVKVASCDEYPAMHCRKHSAFLTDFGGVGDGKTCNTKAFQYAISNLSQYACDGGALLVVPPGKWLTGSFNLTSHFTLFLQKDAVILASQVFTYSPFFSTIINS* |
ORF Type | complete |
Blastp | Probable polygalacturonase from Vitis with 65.22% of identity |
---|---|
Blastx | Probable polygalacturonase from Vitis with 72.65% of identity |
Eggnog | Glycoside hydrolase family 28(COG5434) |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019450638.1) |
Pfam | Pectate lyase superfamily protein (PF12708.6) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer