Protein coding transcript 116294

• Transcript: Ll_transcript_472430
• CDS coordinates: 48-392 (+)
• Peptide sequence: MKLGPKIRNSYVLGSISIIVTLVSVVGGVEYPAINCRKHSAVLTDFGAIGDGTTSNTDAFNSAITNLSQYVNDGGALLVVPPGKWLTGSFNLTSHFTLFLQKDAVILASQDESEW
• ORF Type: 3prime_partial

Annotations of Ll_transcript_472430

• Blastp: Probable polygalacturonase from Vitis with 63.74% of identity
• Blastx: Probable polygalacturonase from Vitis with 67.44% of identity
• Eggnog: Glycoside hydrolase family 28(COG5434)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019426768.1)
• Pfam: Pectate lyase superfamily protein (PF12708.6)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;