Protein coding transcript 1163

• Transcript: Ll_transcript_322248
• CDS coordinates: 112-909 (+)
• Peptide sequence: MEPHHPPQETKPTATTVAITTPCETTNSANSNSSSSKTTTANNTSSNRKCKGKGGPDNNKFRYRGVRQRSWGKWVAEIREPRKRSRKWLGTFSTAEDAARAYDRAAIVLYGSRAQLNLQPSSTSSQSSSSRGSSSSTQTLRPLLPRPSGFGFTSSSSHVPMVFNGAVTSGFVPYGVYPCGGGINNNIVPQVLCPIDNNVVQYRQHHYHQPQQSEQQLQQQQKYHYPESDVGVAGRAIAFSFTHIYILGDCLILFKTSYLYYFRRK*
• ORF Type: complete

Annotations of Ll_transcript_322248

• Blastp: Ethylene-responsive transcription factor ABI4 from Arabidopsis with 54.92% of identity
• Blastx: Ethylene-responsive transcription factor ABI4 from Arabidopsis with 62.82% of identity
• Eggnog: Transcription factor(ENOG410YPH3)
• Kegg: Link to kegg annotations (AT2G40220)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019459291.1)
• Pfam: AP2 domain (PF00847.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;