Protein coding transcript 116394

• Transcript: Ll_transcript_473202
• CDS coordinates: 2-616 (+)
• Peptide sequence: ENADEYMVFDNEALYDICFRTLKLSTPSFGDLNHLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSHGSQQYVSLTVPELTQQMWDAKNMMCAADPRHGRYLTASAMFRGKMSTKEVDEQMINVQNKNSSYFVEWIPNNVKSSVCDIPPRNLRMSSTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWY
• ORF Type: internal

Annotations of Ll_transcript_473202

• Blastp: Tubulin beta chain from Cicer with 97.07% of identity
• Blastx: Tubulin beta chain from Cicer with 97.07% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (101506098)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019436839.1)
• Pfam: Tubulin C-terminal domain (PF03953.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;