Transcript | Ll_transcript_474108 |
---|---|
CDS coordinates | 123-518 (+) |
Peptide sequence | MAFSSSKVSIFCSPSPIGGEVPKNLISFITFVPSSLPTLIQGRGRGNMKICASNVPAPLTGVLFEPFVEVKKDALAVPITPNVSLARQNYADETEAAINEQINVEYNVSYVYHSLFAYFDRDNIAFKGLAK* |
ORF Type | complete |
Blastp | Ferritin-3, chloroplastic from Vigna with 66.17% of identity |
---|---|
Blastx | Ferritin-3, chloroplastic from Vigna with 65.44% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019434545.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer