Protein coding transcript 116417

• Transcript: Ll_transcript_474118
• CDS coordinates: 237-566 (+)
• Peptide sequence: MALASSKVSTCSSLSPIVGDVPKKFISSMSFVLSNSPSSSSLTLSKVGGRGNLMRVCASNESAPLTGVIFEPFEEVKKDVLAVPFTPNVSLARQNYTDESEALINEQIK*
• ORF Type: complete

Annotations of Ll_transcript_474118

• Blastp: Ferritin-2, chloroplastic from Soja with 57.66% of identity
• Blastx: Ferritin-3, chloroplastic from Vigna with 83.81% of identity
• Eggnog: Stores iron in a soluble, non-toxic, readily available form. Important for iron homeostasis (By similarity)(ENOG4111WYH)
• Kegg: -
• CantataDB: Link to cantataDB annotations (CNT0000541)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446500.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;