Protein coding transcript 116418

• Transcript: Ll_transcript_474085
• CDS coordinates: 98-880 (+)
• Peptide sequence: MAHASSKVSAFSSLSPIVGDVPKKFISSMSFVLSNSPCSSSLTLSKEGGRGNLMRVCASNESAPLTGVIFEPFEEVKKDVLAVPFTPNVSLARQNYTDESEALINEQINVEYNVSYVYHSLFAYFDRDNIALKGHAKFFKESSEEEREHAEKFMKYQNTRGGRVILHPITSPVSEFEHVEKGDALYAMELALSMEKLVNEKLLNLHSVAERNNDPQMADYIASEFLQDQVEAIKKIAEYVTQLRMVGKGHGKDIYPYYFS*
• ORF Type: complete

Annotations of Ll_transcript_474085

• Blastp: Ferritin-1, chloroplastic from Soja with 72.73% of identity
• Blastx: Ferritin-3, chloroplastic from Vigna with 82.04% of identity
• Eggnog: Stores iron in a soluble, non-toxic, readily available form. Important for iron homeostasis (By similarity)(ENOG4111TFW)
• Kegg: Link to kegg annotations (547824)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446500.1)
• Pfam: Ferritin-like domain (PF00210.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;