Transcript | Ll_transcript_472799 |
---|---|
CDS coordinates | 358-846 (+) |
Peptide sequence | MGIFDELPLPSDKAYLREDLSRIDESWTAARFDSLPHVVHILTSKDRDNAAQNLKEQSDVVEDVVDEVVQSYHSGFNRAIQNYSQILRLFSESTENISVLKVDLTEAKKRLSARNKQLHQLWYRSVTLRHIISLLDQIEGIAQTVGDSRHSVNNILALCQRS* |
ORF Type | complete |
Blastp | Exocyst complex component SEC8 from Arabidopsis with 81.12% of identity |
---|---|
Blastx | Exocyst complex component SEC8 from Arabidopsis with 81.12% of identity |
Eggnog | Exocyst complex component(ENOG410Z8N0) |
Kegg | Link to kegg annotations (AT3G10380) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019434380.1) |
Pfam | Sec8 exocyst complex component specific domain (PF04048.13) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer