Transcript | Ll_transcript_472942 |
---|---|
CDS coordinates | 197-967 (+) |
Peptide sequence | MVGPTRPQFVLFGSSIVQMSFSHGGWGSILSDIYARKADVLLRGYYGWNSRRALQILNEVFPKGSAAQPSLVIVYFGGNDSMGSHSSGLGPHVPLPEYIENMQKILVHLKNLSERTRVIALSCPPVNEEKVRRNTSTIFSELVRTNELCQSYSEACINLCKELDVKVVDLFNALQKRDDWMDACFTDGIHLAAEGSKIVVKEILKVLKEADWEPCLHWKSMATEYAEDSPYDLVAADGKTTLNPSEWTFYREVQWD* |
ORF Type | complete |
Blastp | GDSL esterase/lipase CPRD49 from Arabidopsis with 69.53% of identity |
---|---|
Blastx | GDSL esterase/lipase CPRD49 from Arabidopsis with 69.53% of identity |
Eggnog | lipolytic protein G-D-S-L family(COG2755) |
Kegg | Link to kegg annotations (AT3G11210) |
CantataDB | Link to cantataDB annotations (CNT0002915) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019414304.1) |
Pfam | GDSL-like Lipase/Acylhydrolase (PF00657.21) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer