Protein coding transcript 116483

• Transcript: Ll_transcript_472954
• CDS coordinates: 200-727 (+)
• Peptide sequence: MGSHSSGLGPHVPLPEYIENMQKILVHLKNLSERTRVIALSCPPVNEEKVRRNTSTIFSELVRTNELCQSYSEACINLCKELDVKVVDLFNALQKRDDWMDACFTDGIHLAAEGSKIVVKEILKVLKEADWEPCLHWKSMATEYAEDSPYDLVAADGKTTLNPSEWTFYREVQWD*
• ORF Type: complete

Annotations of Ll_transcript_472954

• Blastp: GDSL esterase/lipase CPRD49 from Arabidopsis with 65.14% of identity
• Blastx: GDSL esterase/lipase CPRD49 from Arabidopsis with 67.19% of identity
• Eggnog: lipolytic protein G-D-S-L family(COG2755)
• Kegg: Link to kegg annotations (AT3G11210)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019414304.1)
• Pfam: GDSL-like Lipase/Acylhydrolase family (PF13472.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;