| Transcript | Ll_transcript_322214 |
|---|---|
| CDS coordinates | 117-566 (+) |
| Peptide sequence | MERNFNVRHLTIKTELNKSDYKGIVFLLKSCPMLEHLTVELGRARIWPNYVQYGFSPKNFWTENVRIYECLKTSLEVVEVKGFKGFNKSEIRMLAYFILCGKVLKKMIINIEKDITLGCNRNLDLNPHKFAEFLLKVPKASSDLEITIC* |
| ORF Type | complete |
| Blastp | Putative F-box/LRR-repeat protein At1g56400 from Arabidopsis with 34.65% of identity |
|---|---|
| Blastx | F-box protein At3g62230 from Arabidopsis with 31.36% of identity |
| Eggnog | NA(ENOG41113WG) |
| Kegg | Link to kegg annotations (AT1G56400) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019435474.1) |
| Pfam | FBD (PF08387.9) |
| Rfam | - |
| GO | - |
Grab and slide to change sequence position
Alignmet by MSA Viewer