Transcript | Ll_transcript_322214 |
---|---|
CDS coordinates | 117-566 (+) |
Peptide sequence | MERNFNVRHLTIKTELNKSDYKGIVFLLKSCPMLEHLTVELGRARIWPNYVQYGFSPKNFWTENVRIYECLKTSLEVVEVKGFKGFNKSEIRMLAYFILCGKVLKKMIINIEKDITLGCNRNLDLNPHKFAEFLLKVPKASSDLEITIC* |
ORF Type | complete |
Blastp | Putative F-box/LRR-repeat protein At1g56400 from Arabidopsis with 34.65% of identity |
---|---|
Blastx | F-box protein At3g62230 from Arabidopsis with 31.36% of identity |
Eggnog | NA(ENOG41113WG) |
Kegg | Link to kegg annotations (AT1G56400) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019435474.1) |
Pfam | FBD (PF08387.9) |
Rfam | - |
GO | - |
Grab and slide to change sequence position
Alignmet by MSA Viewer