Protein coding transcript 116572

• Transcript: Ll_transcript_429844
• CDS coordinates: 232-957 (+)
• Peptide sequence: MGRGRVQLKRIENKINRQVTFSKRRAGLLKKAHEISVLCDAEVALIVFSNKGKLFEYATDSCMEKILERHERYAYAERQLVTNDCETQGNWTIEYTRLKAKIDLLERNQRHYMGEDLGSMSLKELQSLEQQLDTALKTIRTRRNELMYESISELQKKEKVIQEQNNMLAKKIKEKEKAHVAQQAASWDQSNYRVDTSFLIHHQPLPTLNMGGNQRQEAPEIVRNELDLSLEPFYSCHLGCF*
• ORF Type: complete

Annotations of Ll_transcript_429844

• Blastp: Floral homeotic protein APETALA 1 from Arabidopsis with 69.02% of identity
• Blastx: Floral homeotic protein APETALA 1 from Arabidopsis with 69.02% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (ARALYDRAFT_476039)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019428505.1)
• Pfam: SRF-type transcription factor (DNA-binding and dimerisation domain) (PF00319.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;