Protein coding transcript 116573

• Transcript: Ll_transcript_429845
• CDS coordinates: 215-940 (+)
• Peptide sequence: MGRGRVQLKRIENNINRQVTFSKRRAGLLKKANEISVLCDAEVALIVFSHKGKLFEYATDSCMEKILERHERYAYAERQLVANDSETQGNWTIEYSRLKAKIELLQTNHRHYMGEDLGSMSLKELQSLEQQLDTALKTIRTRRNQLMYESISELQKKEKVIQEQNNMLAKKIKEKEKAHVAQQAASWDQSNYRVDTSFLIHHQPLPTLNMGGNQRQEAPEIVRNELDLSLEPFYSCHLGCF*
• ORF Type: complete

Annotations of Ll_transcript_429845

• Blastp: Floral homeotic protein APETALA 1 from Arabidopsis with 69.02% of identity
• Blastx: Floral homeotic protein APETALA 1 from Arabidopsis with 69.02% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (ARALYDRAFT_476039)
• CantataDB: Link to cantataDB annotations (CNT0000849)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461014.1)
• Pfam: SRF-type transcription factor (DNA-binding and dimerisation domain) (PF00319.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;