Protein coding transcript 116576

• Transcript: Ll_transcript_429851
• CDS coordinates: 2-415 (+)
• Peptide sequence: DTNTVTAFSRSFRSSRKVEVPIEIDENLFFTVGLGLNKCPPNFRARRCQGPNGTRFTASINNVSFVLPNNISILQAHHYGIPGVFTTDFPAKPPLKFDYTGNVSRSLWQPIPGTKAYKLKFGSRVQIVLQDTSIVTSE
• ORF Type: internal

Annotations of Ll_transcript_429851

• Blastp: Laccase-5 from Arabidopsis with 80.58% of identity
• Blastx: Laccase-5 from Arabidopsis with 80.58% of identity
• Eggnog: Multicopper oxidase(COG2132)
• Kegg: Link to kegg annotations (AT2G40370)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437574.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;