Protein coding transcript 116588

• Transcript: Ll_transcript_431531
• CDS coordinates: 235-909 (+)
• Peptide sequence: MAEGKGRVCVTGGTGFIASMMIRRLLSNGYYVNTTTRSAAGKDLSFLTNLPDASEKLRIFNADLNNPESFCPAIEGCKWVFHTATPVDLDEEVETMSKRTVDGALGVLRVSLNSKTVKEVVFTASCTDVIYCGEEVDELDESYWSDIDFINKTKPINWPYSISQLLAEKAVLEFGEKHGLDIVTLVLPFVIGPFICSKLPLSIQMALPWLFGMCSSMCHNPPYI*
• ORF Type: complete

Annotations of Ll_transcript_431531

• Blastp: Vestitone reductase from Medicago with 58.8% of identity
• Blastx: Vestitone reductase from Medicago with 58.8% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AAB41550)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447307.1)
• Pfam: RmlD substrate binding domain (PF04321.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;