Protein coding transcript 116591

• Transcript: Ll_transcript_431542
• CDS coordinates: 153-950 (+)
• Peptide sequence: MAEGKGIVCVTGGTGFIASMMIKRLLSDGYYVNTTTRSAPCKDHSFLTNLPDASEKLKIFKADLNNPESFYPAIEGCKWVFHTATPMDWEEEVDILSERTVNGALGVLKVSLNSKTVKKVVFTASCTNVTYSGEEVDELDESYWSDIDFINKTKPINWPYSISQLLAEKAVLEFGEKHGLDVVTLVLPFVIGPFICPKLPLSIQMTMSWLFGVYDELGVFPSIPIIHVDDVARAHIFMLEHPNIKGRYICSLSGTISMEEIADLVR
• ORF Type: 3prime_partial

Annotations of Ll_transcript_431542

• Blastp: Vestitone reductase from Medicago with 54.65% of identity
• Blastx: Vestitone reductase from Medicago with 54.65% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AAB41550)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447307.1)
• Pfam: NAD dependent epimerase/dehydratase family (PF01370.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;