Protein coding transcript 116636

• Transcript: Ll_transcript_431369
• CDS coordinates: 631-969 (+)
• Peptide sequence: MTKSLTNRLYLKKRVYTLQMQKGRLIKDHLDEFNKIILDLKNIDVKIEDEDQTVLLLCSLPSTYEHFIDTIMYGREDLTLDEVKAALHSKELKKRVSDSRSEGSSESLFARG*
• ORF Type: complete

Annotations of Ll_transcript_431369

• Blastp: Retrovirus-related Pol polyprotein from transposon TNT 1-94 from Nicotiana with 48.28% of identity
• Blastx: Retrovirus-related Pol polyprotein from transposon TNT 1-94 from Nicotiana with 52.88% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_014617136.1)
• Pfam: gag-polypeptide of LTR copia-type (PF14223.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;