Protein coding transcript 1167

• Transcript: Ll_transcript_322226
• CDS coordinates: 58-867 (+)
• Peptide sequence: MGPIIFILLLTSFFSYPFVLIAQSPSISKINVVGTVYCDTCSTTIFSKDSYFLPGAEVHIQCKFRATTPKTSEQIMLSVNRTTDKYGVYKLDVPSVDGINCLDGSAIVSLCQASLIGTSFSSCNVPFLRSTISEISVKSKQDNQCIYTLSALSYKPPQKNTTLCATSTTTLDSSKFYFPYLPPYVFPWPPFPSIPFSPVTPFPSIPFPPITPFPNTPPSLPFPFPSTPPYAFSPPPFKLGDLATWVHYIPYPIPHASPSNPNIPQKSKP*
• ORF Type: complete

Annotations of Ll_transcript_322226

• Blastp: Pollen-specific protein-like At4g18596 from Arabidopsis with 34.18% of identity
• Blastx: Pollen-specific protein-like At4g18596 from Arabidopsis with 34.67% of identity
• Eggnog: pollen Ole e 1 allergen and extensin family protein(ENOG410ZND9)
• Kegg: Link to kegg annotations (AT4G18596)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019455014.1)
• Pfam: Pollen proteins Ole e I like (PF01190.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;