Protein coding transcript 116714

• Transcript: Ll_transcript_430438
• CDS coordinates: 2831-3277 (+)
• Peptide sequence: MGGTGWGMTEFGWDVKYAGVQTLVAKFLMQGKAGHHAAVFEKYQQKAEYFMCSCLGKASNNVRKTPGGLIFRQRWNNMQFVTSASFLATVYSDYLSSSGNSLRCNSGIVSPTELLSLAKTQVIRSSNGILASSVLLYLLCTSFIIVDI*
• ORF Type: complete

Annotations of Ll_transcript_430438

• Blastp: Endoglucanase 6 from Arabidopsis with 79.51% of identity
• Blastx: Endoglucanase 6 from Arabidopsis with 83.06% of identity
• Eggnog: hydrolase family(ENOG410XPC9)
• Kegg: Link to kegg annotations (AT1G64390)
• CantataDB: Link to cantataDB annotations (CNT0000588)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446517.1)
• Pfam: Glycosyl hydrolase family 9 (PF00759.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;