Protein coding transcript 116716

• Transcript: Ll_transcript_430453
• CDS coordinates: 1525-2238 (+)
• Peptide sequence: MVTIQNSSSWYLDSGCSNHMTGNKNWFVTLDKSIDTRIKFADNRTIKAEGIGKVMIKKKDGSISYISSVLYLPRMKSNLLSLGQLFEKRYKMRLEEKMLKVFNKKGVLVLKVPLAHNRTFKIGIQLGNQKCLESVADEKWIWHQRFGHLNFKSLEHLSQDGIVHGLPTIKASNDVCDECLASKQTRNTFCSEVPTKTTQSLEEVYTDVCGPLEADSLGGNKYFVTFKDDFTRKLWIYA
• ORF Type: 3prime_partial

Annotations of Ll_transcript_430453

• Blastp: Retrovirus-related Pol polyprotein from transposon TNT 1-94 from Nicotiana with 32.48% of identity
• Blastx: Retrovirus-related Pol polyprotein from transposon TNT 1-94 from Nicotiana with 28.93% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019451834.1)
• Pfam: GAG-pre-integrase domain (PF13976.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;