Transcript | Ll_transcript_429668 |
---|---|
CDS coordinates | 1605-2423 (+) |
Peptide sequence | MLPFAIFGFFVKPLQLKGFIPANSEKTPALETAVSGVQDEPLSLAEFRDQSSNGHFRSKSETKIFDQFSRLKNDMTALLLNKIYVVNVLGYIAYTFVLGAYSYWGPKVGYNIYHMTNADLVFGGITIVCGIIGTLAGGFVLDFMTNTLSNAFKLLSIATFIGGAFCFGAFLFKSMYGFLVLFSIGELLVFATQGPVNYVCLHCVEPSLRPLSMAMSTVAIHIFGDVPSSPLVGILQDNINNWRMTTLILTAILFPAAGIWFIGKSSCYLSLL* |
ORF Type | complete |
Blastp | Probable sphingolipid transporter spinster homolog 3 from Arabidopsis with 61.36% of identity |
---|---|
Blastx | Probable sphingolipid transporter spinster homolog 3 from Arabidopsis with 61.57% of identity |
Eggnog | major facilitator Superfamily(COG0477) |
Kegg | Link to kegg annotations (AT2G22730) |
CantataDB | Link to cantataDB annotations (CNT0002309) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019418646.1) |
Pfam | Organic Anion Transporter Polypeptide (OATP) family (PF03137.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer