Protein coding transcript 11673

• Transcript: Ll_transcript_317000
• CDS coordinates: 557-1279 (+)
• Peptide sequence: MVFDMHLSSLRNASVKTLWEDDVHPHYVMRRYAEFTASLIHLNAECGDGQLDLNLERLRMAIDDLLIKLAKNFLKPKQQTVFLINNYDMTISVLKEAGPEGGKILMHFEELLKSNTALFVEELLQEHFSDLIKFVKAKASEDSTSSPDKPITIAEVEPLVKDFASRWKGAIELMHKDVITSFSNFLCGMEILRAALTQLLLYYTRLSDCIKRIVGGSALNKDLVSISSIMYEIRKYSRTF*
• ORF Type: complete

Annotations of Ll_transcript_317000

• Blastp: Vacuolar protein sorting-associated protein 52 A from Arabidopsis with 83.33% of identity
• Blastx: Vacuolar protein sorting-associated protein 52 A from Arabidopsis with 81.3% of identity
• Eggnog: vacuolar protein sorting 52 homolog (S. cerevisiae)(ENOG410XNZ1)
• Kegg: Link to kegg annotations (AT1G71270)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019420934.1)
• Pfam: Vps52 / Sac2 family (PF04129.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;