Protein coding transcript 116741

• Transcript: Ll_transcript_429580
• CDS coordinates: 3-851 (+)
• Peptide sequence: FSCASNQVAQVLLTLPYSFSQLGMLSGILLQIFYGLLGSWTAYLISVLYVEYRARKEKENTNFKNHVIQWFEVLDGLLGSYWKAIGLAFNCTFLLFGSVIQLIACASNIYYINDKLDKRTWTYIFGACCATTVFIPSFHNYRIWSFLGLGMTTYTAWYMAIAALVHGQVENVTHSGPNKLVLYFTGATNILYTFGGHAVTVEIMHAMWKPQKFKYIYLMATLYVFTLTLPSSAAVYWAFGDELLNHSNAFSLLPKNGFRDAAVILMLIHQVTYISCIFWCIK*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_429580

• Blastp: Auxin transporter-like protein 4 from Medicago with 93.12% of identity
• Blastx: Auxin transporter-like protein 4 from Medicago with 93.7% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (MTR_4g415390)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413077.1)
• Pfam: Transmembrane amino acid transporter protein (PF01490.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;