Protein coding transcript 116742

• Transcript: Ll_transcript_429581
• CDS coordinates: 2-580 (+)
• Peptide sequence: LLNHSNAFSLLPKNGFRDAAVILMLIHQFITFGFACTPLYFVWEKVIGMHNTRSICVRALARLPVVIPIWFLAIIFPFFGPINSAVGALLVSFTVYIIPSLAHMLTYRKASARQNAAEKPPFFLPSWTAMYVINAFIVVWVFVVGFGFGGWASMTNFIRQIDTFGLFAKCYQCHPPTPPSVAAAPPPHALHH*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_429581

• Blastp: Auxin transporter protein 1 from Arabidopsis with 85.94% of identity
• Blastx: Auxin transporter-like protein 2 from Medicago with 93.64% of identity
• Eggnog: amino acid transport(COG0814)
• Kegg: Link to kegg annotations (AT2G38120)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413077.1)
• Pfam: Transmembrane amino acid transporter protein (PF01490.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;