Protein coding transcript 116809

• Transcript: Ll_transcript_431480
• CDS coordinates: 3-545 (+)
• Peptide sequence: LTCRKIVNWRTYLKFPEEANLSAEAKDLISQLLCNVEQRLGAKGADEIKAHPWFKGIEWDKLYQMEAAFIPEVNGELDTQNFEKFEEVDKETLTPSKTGPWRKMLSSKDVNFVGYTYKNFEIVNDDGLPGIAELKKSAKTKRPSIKTIFADESDTAANQHDQGSYLKPMPTQEEVPEKSE*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_431480

• Blastp: Serine/threonine-protein kinase CBK1 from Pneumocystis with 44.96% of identity
• Blastx: Serine/threonine-protein kinase CBK1 from Pneumocystis with 44.96% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019432752.1)
• Pfam: Protein kinase C terminal domain (PF00433.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;