Transcript | Ll_transcript_431480 |
---|---|
CDS coordinates | 3-545 (+) |
Peptide sequence | LTCRKIVNWRTYLKFPEEANLSAEAKDLISQLLCNVEQRLGAKGADEIKAHPWFKGIEWDKLYQMEAAFIPEVNGELDTQNFEKFEEVDKETLTPSKTGPWRKMLSSKDVNFVGYTYKNFEIVNDDGLPGIAELKKSAKTKRPSIKTIFADESDTAANQHDQGSYLKPMPTQEEVPEKSE* |
ORF Type | 5prime_partial |
Blastp | Serine/threonine-protein kinase CBK1 from Pneumocystis with 44.96% of identity |
---|---|
Blastx | Serine/threonine-protein kinase CBK1 from Pneumocystis with 44.96% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019432752.1) |
Pfam | Protein kinase C terminal domain (PF00433.23) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer