Transcript | Ll_transcript_431495 |
---|---|
CDS coordinates | 283-633 (+) |
Peptide sequence | MEAAFIPEVNGELDTQNFEKFEEVDKETLTPSKTGPWRKMLSSKDVNFVGYTYKNFEIVNDDGLPGIAELKKSAKTKRPSIKTIFADESDTAANQHDQGSYLKPMPTQEEVPEKSE* |
ORF Type | complete |
Blastp | - |
---|---|
Blastx | Serine/threonine-protein kinase CBK1 from Pneumocystis with 56.6% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019432752.1) |
Pfam | Protein kinase C terminal domain (PF00433.23) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer