Protein coding transcript 116837

• Transcript: Ll_transcript_430795
• CDS coordinates: 153-728 (+)
• Peptide sequence: MLCLFPHFFIRTWEGGMYVHLSFLILDNRIMEVFVRAPEIDISELESLFSAASVSDGSSIKGGGRRGTNINKPEKVQLVDLRRAYNCEIMLSKIKIPLPDMLNAVLALDSSVLDIDQVENLIKFCPTKEEMEMLKNYTGKKEMLGKCEQFFMELMKVPRVEAKLRVFAFKITFSSQVNDLRVNLNTINDATR
• ORF Type: 3prime_partial

Annotations of Ll_transcript_430795

• Blastp: Formin-like protein 14 from Arabidopsis with 77.51% of identity
• Blastx: Formin-like protein 14 from Arabidopsis with 77.51% of identity
• Eggnog: actin cytoskeleton organization(ENOG410XT5Z)
• Kegg: Link to kegg annotations (AT1G31810)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019445199.1)
• Pfam: Formin Homology 2 Domain (PF02181.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;