Protein coding transcript 116848

• Transcript: Ll_transcript_430801
• CDS coordinates: 1-855 (+)
• Peptide sequence: SAPPPPPPPGIRTGSAPPPPPPAPIGPKRMGSAPPPPPPAPKPPGAPPPPPGRGAMPAPPPPPGGKAPGVPPPGKTSLAPTNVGKGRGIGGTVVAPKRTLLKPLHWVKVARAAKGSLWADSQKQDNESRAPEIDISELESLFSAVSISDGSSTKGGGRRGTNINKPVKVQLVDLRRAYNCEIMLSKIKIPLQDMLNAVLALDSSVLDIDQVENLIKFCPTKEEMEMLKNYTGNKEMLGKCEQFFMELMKVPRVEAKLRVFAFKTTFSSQVNDLRVNLNTINDATR
• ORF Type: internal

Annotations of Ll_transcript_430801

• Blastp: Formin-like protein 14 from Arabidopsis with 71.19% of identity
• Blastx: Formin-like protein 14 from Arabidopsis with 75.98% of identity
• Eggnog: actin cytoskeleton organization(ENOG410XT5Z)
• Kegg: Link to kegg annotations (AT1G31810)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424055.1)
• Pfam: Formin Homology 2 Domain (PF02181.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;