Transcript | Ll_transcript_430870 |
---|---|
CDS coordinates | 210-1691 (+) |
Peptide sequence | MSGAIDMDHVGFSKAKSTAAPAASHGKKTGPVSMDHVLLALHETKEERDIRIRSLFNFFDAANNGYLDYAQIEAGLSALQIPPEYKYAKDLFKVCDADRDGRIDYDDFRRYMDDKELELYRIFQAIDVEHSGCILPEELWDALVKAGIEMDEEELARFVEHVDKDNNGIITFEEWRDFLLLYPHEATIENIYHHWERVCLVDIGEQAVIPEGISKHVHRSRYFIAGGIAGAASRTATAPLDRLKVVLQVQTGRASIMPAIMKIWKQDGLLGFFRGNGLNVVKVAPESAIKFYAYEMLKNVIGEGQGNKSADIGTAGRLFAGGMAGAIAQMAIYPMDLIKTRLQTCDSDGGRVPKLGRLTKDIWVQEGPRAFYRGLVPSLLGIIPYAGIDLAAYETLKDISKRHILNDSEPGVIVQLGCGTVSGALGATCVYPLQVIRTRLMAQPTNTSDAYKGMSDAFWRTFQHEGFKGFYKGLFPNLLKVVPAASITYMVYET |
ORF Type | 3prime_partial |
Blastp | Calcium-binding mitochondrial carrier protein SCaMC-2 from Silurana with 38.6% of identity |
---|---|
Blastx | Calcium-binding mitochondrial carrier protein SCaMC-1 from Silurana with 38.89% of identity |
Eggnog | Solute carrier family 25 (Mitochondrial carrier(ENOG410XQ4P) |
Kegg | Link to kegg annotations (496462) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019458044.1) |
Pfam | EF-hand domain pair (PF13833.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer