Protein coding transcript 116936

• Transcript: Ll_transcript_429881
• CDS coordinates: 154-645 (+)
• Peptide sequence: MGSKIKLLGMCIWLFYLPSFTFIVVNTQDNESGRSATLKGSVVINGRSVIGNIDDDFVCATLDWWPPQKCDYGRCSWGLASLLNLVLLLFFFLSKLFLILLRFFLRMFNCCKFFYDNVSISSFYCLLTRSDVFSIFLMLALDLLVQLQNNYCIKFNLLILLFS*
• ORF Type: complete

Annotations of Ll_transcript_429881

• Blastp: Heparanase-like protein 3 from Arabidopsis with 61.9% of identity
• Blastx: Heparanase-like protein 3 from Arabidopsis with 63.54% of identity
• Eggnog: Heparanase(ENOG410YDJW)
• Kegg: Link to kegg annotations (AT5G34940)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417502.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;