Protein coding transcript 117087

• Transcript: Ll_transcript_429087
• CDS coordinates: 1542-1958 (+)
• Peptide sequence: MLECDECKSSPNNTITIPDLNHEELESLLEFLYSGTLATQTLEKHVYTLSRAADKYIIPHLLKHCERHLLSSLNISNALQTLDIADSCSNHNLKETTLNFLVKNFEHVVSSTKFEAFVHRSPHLTVQLVTRAFANGAK*
• ORF Type: complete

Annotations of Ll_transcript_429087

• Blastp: BTB/POZ domain-containing protein At3g56230 from Arabidopsis with 49.62% of identity
• Blastx: BTB/POZ domain-containing protein At3g56230 from Arabidopsis with 51.41% of identity
• Eggnog: meprin and TRAF homology domain-containing protein MATH domain-containing protein(ENOG410XQV8)
• Kegg: Link to kegg annotations (AT3G56230)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019416862.1)
• Pfam: BTB/POZ domain (PF00651.30)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;