Protein coding transcript 117119

• Transcript: Ll_transcript_431807
• CDS coordinates: 3-482 (+)
• Peptide sequence: IAKSIEKAKSLFEEGGDWERKNRLKVYEGLYCMSTRNFKKAADLFLDSISTFTTYELFPYDTFIFYTVLTSIISLDRVSLKQKVVDAPEILTVIGKVPHLSEFLNSLYDCQYKSFFTAFGQQRYSIFCYCCSYFLKLFDSSISLNTRVLFLYCYTLDFV*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_431807

• Blastp: 26S proteasome non-ATPase regulatory subunit 6 from Oryza sativa with 91.6% of identity
• Blastx: 26S proteasome non-ATPase regulatory subunit 6 from Oryza sativa with 91.6% of identity
• Eggnog: Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 6(COG5187)
• Kegg: Link to kegg annotations (4336206)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019434025.1)
• Pfam: 26S proteasome subunit RPN7 (PF10602.8)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;