| Transcript | Ll_transcript_429492 |
|---|---|
| CDS coordinates | 354-662 (+) |
| Peptide sequence | MAEEDTKPLNYIPEVILKKRKSSEAWALRKKEQFRMRNFQSNKNKDLIKKPLDFVFQFRNRMKRRVKRKLAELLTSNSKPLIIIRIQGKKDMHPHAERSYIA* |
| ORF Type | complete |
| Blastp | 60S ribosomal protein L7-1 from Arabidopsis with 46.67% of identity |
|---|---|
| Blastx | 60S ribosomal protein L7-1 from Arabidopsis with 46.67% of identity |
| Eggnog | ribosomal large subunit biogenesis(COG1841) |
| Kegg | Link to kegg annotations (AT1G80750) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019462279.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer