Protein coding transcript 117306

• Transcript: Ll_transcript_431414
• CDS coordinates: 254-745 (+)
• Peptide sequence: MVDQVQHPALYQRRSFGNYSNAALQYPVMPSCRATTDFSSVATASPVFAAAPAEKGHFVIDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKSGRLSEPYKGIGDCFKRTTAEEGVVALWRGNTANVIRYFPTQALNFAFKDYFKRLFNFKKDRDGYWKWFA
• ORF Type: 3prime_partial

Annotations of Ll_transcript_431414

• Blastp: ADP,ATP carrier protein 1, mitochondrial from Gossypium with 80.98% of identity
• Blastx: ADP,ATP carrier protein 1, mitochondrial from Gossypium with 79.14% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413427.1)
• Pfam: Mitochondrial carrier protein (PF00153.26)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;