| Transcript | Ll_transcript_431396 |
|---|---|
| CDS coordinates | 54-422 (+) |
| Peptide sequence | MVEQVQHPTIMEKVASQLHRRSSVSSDVQNYDAAFRRPAVYQRRSFGNYSNAALQYPLMPSCGATSDLSSVATASPVFVAAPAEKGHFLIDFLMGGVSAAVSKTAAAPIERVKLLSQNQDEMI |
| ORF Type | 3prime_partial |
| Blastp | ADP,ATP carrier protein 1, mitochondrial from Gossypium with 67.46% of identity |
|---|---|
| Blastx | ADP,ATP carrier protein 1, mitochondrial from Gossypium with 67.46% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | egu-MIR172e (MI0020571) |
| Ncbi protein | Link to NCBI protein (XP_019449581.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer